PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0619s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 473aa    MW: 52080.1 Da    PI: 6.8878
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0619s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.4e-30246300155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rW pe+He+Fveav++L G+ekAtPk +l+lm++k Lt++hvkSHLQkYRl
  Kalax.0619s0010.2.p 246 KPRMRWLPEIHECFVEAVNKLDGPEKATPKGVLKLMNMKNLTIYHVKSHLQKYRL 300
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.58E-15244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28245301IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-22246301IPR006447Myb domain, plants
PfamPF002491.6E-5248299IPR001005SANT/Myb domain
PfamPF143792.9E-21336383IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MSKKQSQPPK RVTLPVCSSP PHPKCAATEL QNVALFSTCS TFLSSPQTDH VEAHNLISKS  60
AIVPFKSYAH QSKTTHCPSS LFCTNLYQSS SSTSEAHRQL GNPPFLPNPP PSTHPLSHFH  120
AQTSPLHFSG ASRSCSYHEQ QANDDLMGDF TYMHGDSFDG SFHGLNSGNN DIGISDQLDL  180
HFLSDELDIA MTHSGDNPGI DELYEVPKES LKSSVELTCN SNCNSSALVG DATSGEMSPG  240
LCTAHKPRMR WLPEIHECFV EAVNKLDGPE KATPKGVLKL MNMKNLTIYH VKSHLQKYRL  300
AKYMQERKED KNLSSNEAKK ATSSCNESDG RRKGSIQVTE ALRMQMEVQK QLHEQLEVQR  360
ALQLRIEEHA RHLQKILEEQ QKAGNQFISL HSLSSLTSSS TCTNTALEPT KPTSPVLSSH  420
DEATVSKTEL SLASGHKEIN SNDSEEPGRK RPRLETKFEN TPCDGVPSGQ NP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008355263.11e-133PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLM5X4S61e-126M5X4S6_PRUPE; Uncharacterized protein
STRINGVIT_09s0054g01620.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-93G2-like family protein